SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1cj2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1cj2A
Domain Number 1 Region: 1-172,274-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.45e-58
Family FAD-linked reductases, N-terminal domain 0.000000000239
Further Details:      
 
Domain Number 2 Region: 175-275
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.95e-46
Family PHBH-like 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1cj2A   PDB: 1cj2
Sequence length 391
Comment (A:)
Sequence
mktqvaiigagpsglllgqllhkagidnvilerrtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekvedwsderfw
telkarlpaevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
qriqqteleyylgseaglatiaenyvglpye
Download sequence
Identical sequences 1cj2A 1cj2_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]