SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1clwA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1clwA
Domain Number 1 Region: 1-554
Classification Level Classification E-value
Superfamily Pectin lyase-like 0
Family P22 tailspike protein 0.000000000000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1clwA   PDB: 1clw   SUPERFAMILY: 1clwA
Sequence length 554
Comment (A:)
Sequence
ysieadkkfkysvklsdyptlqdaasaavdgllidrdynfyggetvdfggkvltieckak
figdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqsktdgy
qptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgchfckm
vdannpsggkdgiitfenlsgdwgkgnyviggrtsygsassaqflrnnggferdggvigf
tsyragesgvktwqgtvgsttsrnynlqfrdsvviypvwdgfdlgadtdmnpeldrpgdy
pitqyplhqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllthesvf
tniaiidtntkdfqanqiyisgacrvnglrligirstdgqgltidapnstvsgitgmvdp
srinvanlaeeglgniransfgydsaaiklrihklsktldsgalyshinggagsgsaytq
ltaisgstpdavslkvnhkdcrgaeipfvpdiasddfikdsscflpywennstslkalvk
kpngelvrltlatl
Download sequence
Identical sequences 1clw_A cath|current|1clwA00/113-666 d1clwa_ 1clwA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]