SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1cooA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1cooA
Domain Number 1 Region: 24-83
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 2.64e-35
Family C-terminal domain of RNA polymerase alpha subunit 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1cooA   PDB: 1coo   SUPERFAMILY: 1cooA
Sequence length 98
Comment (A:)
Sequence
mdlrdvrepevkeekpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellk
tpnlgkkslteikdvlasrglslgmrlenwppasiade
Download sequence
Identical sequences 1coo_A 1cooA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]