SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ct9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ct9A
Domain Number 1 Region: 209-478
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.9e-76
Family N-type ATP pyrophosphatases 0.000000000364
Further Details:      
 
Domain Number 2 Region: 3-195
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.03e-55
Family Class II glutamine amidotransferases 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ct9A   PDB: 1ct9
Sequence length 553
Comment (A:)
Sequence
asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
iisaitkkyaarrvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihft
vqegldairdviyhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyf
hkapnakelheetvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdk
mcgngkmekhilrecfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqleta
rfrfpyntptskeaylyreifeelfplpsaaecvpggpsvacssakaiewdeafkkmddp
sgravgvhqsayk
Download sequence
Identical sequences 1ct9_A 1ct9_B 1ct9_C 1ct9_D 1ct9A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]