SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1d2pA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1d2pA
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Cna protein B-type domain 1.69e-30
Family Cna protein B-type domain 0.00000215
Further Details:      
 
Domain Number 2 Region: 189-277
Classification Level Classification E-value
Superfamily Cna protein B-type domain 2.54e-30
Family Cna protein B-type domain 0.00000215
Further Details:      
 
Domain Number 3 Region: 93-186
Classification Level Classification E-value
Superfamily Cna protein B-type domain 2.1e-25
Family Cna protein B-type domain 0.00000141
Further Details:      
 
Domain Number 4 Region: 280-372
Classification Level Classification E-value
Superfamily Cna protein B-type domain 2.82e-25
Family Cna protein B-type domain 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1d2pA   PDB: 1d2p
Sequence length 373
Comment (A:)
Sequence
ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
kkieytvtedhvkdyttdingttitnkytpgetsatvtknwddnnnqdgkrpteikvely
qdgkatgktailnesnnwthtwtgldekakgqqvkytveeltkvkgytthvdnndmgnli
ttnkytpettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkd
lpkydegkkieytvtedhvkdyttdingttitnkytpgetsatvtknwddnnnqdgkrpt
eikvelyqdgkatgktailnesnnwthtwtgldekakgqqvkytveeltkvkgytthvdn
ndmgnlittnkyt
Download sequence
Identical sequences 1d2pA 1d2p_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]