SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1d4oA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1d4oA
Domain Number 1 Region: 5-177
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.06e-140
Family Transhydrogenase domain III (dIII) 0.0000000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1d4oA   PDB: 1d4o   SUPERFAMILY: 1d4oA
Sequence length 184
Comment (A:)
Sequence
meisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlseqgkkvrfgi
hpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpns
iiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvre
syqk
Download sequence
Identical sequences 1d4oA cath|current|1d4oA00/5-181 1d4o_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]