SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1djlA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1djlA
Domain Number 1 Region: 28-200
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.43e-141
Family Transhydrogenase domain III (dIII) 0.0000000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1djlA   PDB: 1djl   SUPERFAMILY: 1djlA
Sequence length 207
Comment (A:)
Sequence
mnrslanvilggygttstaggkpmeisgthteinldnaidmireansiiitpgyglcaak
aqypiadlvkmlteqgkkvrfgihpvagrmpgqlnvllaeagvpydivlemdeinhdfpd
tdlvlvigandtvnsaaqedpnsiiagmpvlevwkskqvivmkrslgvgyaavdnpifyk
pntamllgdakktcdalqakvresyqk
Download sequence
Identical sequences 1djl_A 1djl_B 1pt9_A 1pt9_B 1u31_A 1u31_B 1djlA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]