SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1dk5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dk5A
Domain Number 1 Region: 14-320
Classification Level Classification E-value
Superfamily Annexin 1.03e-135
Family Annexin 0.000000000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dk5A   PDB: 1dk5   SUPERFAMILY: 1dk5A
Sequence length 322
Comment (A:)
Sequence
mahhhhhhmasltvpahvpsaaedceqlrsafkgwgtnekliisilahrtaaqrklirqt
yaetfgedllkeldrelthdfeklvlvwtldpserdahlakeatkrwtksnfvlvelact
rspkelvlareayharykksleedvayhttgdhrkllvplvssyryggeevdlrlakaes
kilhekisdkaysddevirilatrskaqlnatlnhykdehgedilkqledgdefvallra
tikglvypehyfvevlrdainrrgteedhltrviatraevdlkiiadeyqkrdsiplgra
iakdtrgdyesmllallgqeed
Download sequence
Identical sequences 1dk5A 1dk5_A 1dk5_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]