SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1dkmA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dkmA
Domain Number 1 Region: 4-407
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 2.22e-80
Family Histidine acid phosphatase 0.00000000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dkmA   PDB: 1dkm   SUPERFAMILY: 1dkmA
Sequence length 410
Comment (A:)
Sequence
qsepelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylgh
yqrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqtdtss
pdplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclk
rekqdescsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritds
hqwntllslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfi
aghdtnlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqm
rdktplslntppgevkltlagceernaqgmcslagftqivnearipacsl
Download sequence
Identical sequences d1dkma_ d1dkna_ d1dkoa_ 1dkm_A 1dkn_A 1dko_A 1dkmA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]