SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1dkpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dkpA
Domain Number 1 Region: 4-407
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 3.62e-75
Family Histidine acid phosphatase 0.00000000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dkpA   PDB: 1dkp   SUPERFAMILY: 1dkpA
Sequence length 410
Comment (A:)
Sequence
qsepelklesvvivsragvraptkatqlmqdvtpdawptwpvklgwltprggeliaylgh
yqrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqtdtss
pdplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclk
rekqdescsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritds
hqwntllslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfi
aghdtnlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqm
rdktplslntppgevkltlagceernaqgmcslagftqivnearipacsl
Download sequence
Identical sequences d1dkpa_ d1dkqa_ 1dkp_A 1dkq_A 1dkpA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]