SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1dkzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dkzA
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 3.15e-60
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.000000491
Further Details:      
 
Domain Number 2 Region: 119-214
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 8.78e-32
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dkzA   PDB: 1dkz
Sequence length 219
Comment (A:)
Sequence
vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
ltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
Download sequence
Identical sequences 1dkzA 1dky_A 1dky_B 1dkz_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]