SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1dm5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dm5A
Domain Number 1 Region: 3-312
Classification Level Classification E-value
Superfamily Annexin 4.47e-181
Family Annexin 0.0000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dm5A   PDB: 1dm5   SUPERFAMILY: 1dm5A
Sequence length 315
Comment (A:)
Sequence
vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdknalidilctqsnaqih
aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
csgdykdlllqitgh
Download sequence
Identical sequences 1dm5_A 1dm5_B 1dm5_C 1dm5_D 1dm5_E 1dm5_F 1dm5A d1dm5a_ d1dm5b_ d1dm5c_ d1dm5d_ d1dm5e_ d1dm5f_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]