SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1dqeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dqeA
Domain Number 1 Region: 5-136
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 5.35e-44
Family Insect pheromone/odorant-binding proteins 0.00000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dqeA   PDB: 1dqe   SUPERFAMILY: 1dqeA
Sequence length 137
Comment (A:)
Sequence
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavge
Download sequence
Identical sequences 1dqeA 1dqe_A 1dqe_B 000003202|e1dqeA1|108.2.1.10|A:1-137 000049453|e1ls8A1|108.2.1.10|A:1-137 000049456|e1gm0A1|108.2.1.10|A:1-137 000049457|e1dqeB1|108.2.1.10|B:1-137 cath|current|1dqeA00/1-137 cath|current|1dqeB00/1-137 d1dqea_ d1dqeb_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]