SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1du6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1du6A
Domain Number 1 Region: 12-62
Classification Level Classification E-value
Superfamily Homeodomain-like 3.92e-31
Family Homeodomain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1du6A   PDB: 1du6   SUPERFAMILY: 1du6A
Sequence length 64
Comment (A:)
Sequence
ssghiegrhmnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkrir
ykkn
Download sequence
Identical sequences 1du6_A 001160039|e1du6A2|101.1.1.10|A:1-64 cath|current|1du6A00/1-64 1du6A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]