SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1e1hA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1e1hA
Domain Number 1 Region: 45-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.22e-94
Family Clostridium neurotoxins, catalytic domain 0.0000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1e1hA   PDB: 1e1h
Sequence length 287
Comment (A:)
Sequence
mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamaykdpvngvdiayik
ipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakqvpvsyydstylstdne
kdnylkgvtklferiystdlgrmlltsivrgipfwggstidtelkvidtncinviqpdgs
yrseelnlviigpsadiiqfecksfghdvlnltrngygstqyirfspdftfgfeeslevd
tnpllgagkfatdpavtlahelihaehrlygiainpnrvfkvntnay
Download sequence
Identical sequences 1e1h_A 1e1h_C 1e1hA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]