SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1e1hB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1e1hB
Domain Number 1 Region: 2-166
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.4e-68
Family Clostridium neurotoxins, catalytic domain 0.000000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1e1hB   PDB: 1e1h
Sequence length 174
Comment (B:)
Sequence
yemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigttasl
qymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktylnfd
kavfrinivpdenytikdgfnlkganlstnfngqnteinsrnftrllehhhhhh
Download sequence
Identical sequences 1e1hB 1e1h_B 1e1h_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]