SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1e1oA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1e1oA
Domain Number 1 Region: 155-501
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.79e-228
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000148
Further Details:      
 
Domain Number 2 Region: 18-159
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.09e-77
Family Anticodon-binding domain 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1e1oA   PDB: 1e1o
Sequence length 504
Comment (A:)
Sequence
seqetrganeaidfndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqel
eslnievsvagrmmtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdi
igargtlfktqtgelsihctelrlltkalrplpdkfhglqdqevryrqryldliandksr
qtfvvrskilaairqfmvargfmevetpmmqvipggasarpfithhnaldldmylriape
lylkrlvvggfervfeinrnfrnegisvrhnpeftmmelymayadyhdlielteslfrtl
aqevlgttkvtygehvfdfgkpfekltmreaikkyrpetdmadldnfdaakalaesigit
vekswglgrivteifdevaeahliqptfiteypaevsplarrndvnpeitdrfeffiggr
eigngfselndaedqaerfqeqvnakaagddeamfydedyvtaleyglpptaglgigidr
mimlftnshtirdvilfpamrpqk
Download sequence
Identical sequences 1e1oA 1e1o_A 1e1t_A 1e22_A 1e24_A 1lyl_A 1lyl_B 1lyl_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]