SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1e3aB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1e3aB
Domain Number 1 Region: 2-559
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.7e-151
Family Penicillin acylase, catalytic domain 3.02e-16
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1e3aB   PDB: 1e3a
Sequence length 560
Comment (B:)
Sequence
ptgsnmwvigkskaqdakaimvngpqfgwyapaytygiglhgagydvtgntpfaypglvf
ghngviswgstagfgddvdifaerlsaekpgyylhngkwvkmlsreetitvkngqaetft
vwrtvhgnilqtdqttqtayaksrawdgkevasllawthqmkaknwqewtqqaakqalti
nwyyadvngnigyvhtgaypdrqsghdprlpvpgtgkwdwkgllpfemnpkvynpqsgyi
anwnnspqkdypasdlfaflwggadrvteidrlleqkprltadqawdvirqtsrqdlnlr
lflptlqaatsgltqsdprrqlvetltrwdginllnddgktwqqpgsailnvwltsmlkr
tvvaavpmpfdkwysasgyettqdgptgslnisvgakilyeavqgdkspipqavdlfagk
pqqevvlaaledtwetlskrygnnvsnwktpamaltfrannffgvpqaaaeetrhqaeyq
nrgtendmivfspttsdrpvlawdvvapgqsgfiapdgtvdkhyedqlkmyenfgrkslw
ltkqdveahkesqevlhvqr
Download sequence
Identical sequences 1e3a_B 1e3aB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]