SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1e6eB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1e6eB
Domain Number 1 Region: 6-109
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.94e-46
Family 2Fe-2S ferredoxin-related 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1e6eB   PDB: 1e6e   SUPERFAMILY: 1e6eB
Sequence length 128
Comment (B:)
Sequence
gssedkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlife
qhifekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvpdavsdaresidm
gmnsskie
Download sequence
Identical sequences cath|current|1e6eB00/5-117 1e6e_B 1e6e_D 1e6eB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]