SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1e9tA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1e9tA
Domain Number 1 Region: 6-54
Classification Level Classification E-value
Superfamily Trefoil 5.12e-18
Family Trefoil 0.0000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1e9tA   PDB: 1e9t   SUPERFAMILY: 1e9tA
Sequence length 59
Comment (A:)
Sequence
eeyvglsanqcavpakdrvdcgyphvtpkecnnrgccfdsripgvpwcfkplqeaectf
Download sequence
Identical sequences 1e9tA 1e9t_A 1pe3_1 1pe3_2 cath|current|1e9tA00/1-59 cath|current|1pe3100/1-59 cath|current|1pe3200/1-59 d1e9ta_ d1pe31_ d1pe32_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]