SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ef2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ef2A
Domain Number 1 Region: 129-430,479-566
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 8.46e-198
Family alpha-subunit of urease, catalytic domain 0.0000000000012
Further Details:      
 
Domain Number 2 Region: 2-176
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 1.1e-62
Family alpha-Subunit of urease 0.000000834
Further Details:      
 
Domain Number 3 Region: 421-476
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.000000427
Family alpha-Subunit of urease 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ef2A   PDB: 1ef2
Sequence length 566
Comment (A:)
Sequence
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrml
qaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdi
qvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnpt
lpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssds
qamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahev
gsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf
Download sequence
Identical sequences 1ef2A 1ef2_A 4ep8_C 4epb_C 4epd_C 4epe_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]