SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1efpB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1efpB
Domain Number 1 Region: 1-248
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.7e-128
Family ETFP subunits 0.00000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1efpB   PDB: 1efp   SUPERFAMILY: 1efpB
Sequence length 252
Comment (B:)
Sequence
MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIA
VSIGVKQAAETLRTALAMGADRAILVVAADDVQQDIEPLAVAKILAAVARAEGTELIIAG
KQAIDNDMNATGQMLAAILGWAQATFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTA
DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVVSVREPEGRKAGIKVGSVD
ELVGKLKEAGVI
Download sequence
Identical sequences P38975
1efpB cath|current|1efpB00/1-246 cath|current|1efpD00/1-246 1efp_B 1efp_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]