SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1efvB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1efvB
Domain Number 1 Region: 5-251
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.69e-128
Family ETFP subunits 0.00000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1efvB   PDB: 1efv   SUPERFAMILY: 1efvB
Sequence length 255
Comment (B:)
Sequence
MAELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKE
VIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLV
LLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAV
VTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVE
TTEDLVAKLKEIGRI
Download sequence
Identical sequences P38117
NP_001976.1.87134 NP_001976.1.92137 ENSP00000311930 1efv_B 1t9g_S cath|current|1efvB00/4-255 ENSP00000311930 1efvB gi|4503609|ref|NP_001976.1| Hs4503609___KOG3180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]