SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ej0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ej0A
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.2e-89
Family RNA methyltransferase FtsJ 0.000000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ej0A   PDB: 1ej0   SUPERFAMILY: 1ej0A
Sequence length 180
Comment (A:)
Sequence
glrsrawfkldeiqqsdklfkpgmtvvdlgaapggwsqyvvtqiggkgriiacdllpmdp
ivgvdflqgdfrdelvmkallervgdskvqvvmsdmapnmsgtpavdipramylvelale
mcrdvlapggsfvvkvfqgegfdeylreirslftkvkvrkpdssrarsrevyivatgrkp
Download sequence
Identical sequences 1eiz_A 1ej0_A 000009324|e1ej0A1|2003.1.5.13|A:1-180 000099420|e1eizA1|2003.1.5.13|A:1-180 cath|current|1eizA00/30-209 cath|current|1ej0A00/30-209 d1eiza_ d1ej0a_ 1ej0A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]