SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ejxC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ejxC
Domain Number 1 Region: 130-431,480-567
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 8.46e-198
Family alpha-subunit of urease, catalytic domain 0.0000000000012
Further Details:      
 
Domain Number 2 Region: 2-177
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 5.13e-63
Family alpha-Subunit of urease 0.000000834
Further Details:      
 
Domain Number 3 Region: 422-477
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.000000427
Family alpha-Subunit of urease 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ejxC   PDB: 1ejx
Sequence length 567
Comment (C:)
Sequence
MSNISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM
LAADCVDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIA
AEGKIVTAGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRM
LQAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLKIHEDWGATPAAIDCALTVADEMD
IQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNP
TLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDVLHDLGAFSLTSSD
SQAMGRVGEVILRTWQVAHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHE
VGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGAL
GSARHHCRLTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQT
YEVRVDGELITSEPADVLPMAQRYFLF
Download sequence
Identical sequences A0A099PL24 A6TE42 P18314
272620.KPN_03467 1ejxC WP_015958999.1.10061 WP_015958999.1.10092 WP_015958999.1.10102 WP_015958999.1.101034 WP_015958999.1.101749 WP_015958999.1.10194 WP_015958999.1.101972 WP_015958999.1.10203 WP_015958999.1.102075 WP_015958999.1.102146 WP_015958999.1.11020 WP_015958999.1.11036 WP_015958999.1.11237 WP_015958999.1.11349 WP_015958999.1.11502 WP_015958999.1.11808 WP_015958999.1.11864 WP_015958999.1.12079 WP_015958999.1.12462 WP_015958999.1.12747 WP_015958999.1.13386 WP_015958999.1.13450 WP_015958999.1.13541 WP_015958999.1.13773 WP_015958999.1.14090 WP_015958999.1.14109 WP_015958999.1.14252 WP_015958999.1.14290 WP_015958999.1.14407 WP_015958999.1.1441 WP_015958999.1.14585 WP_015958999.1.14594 WP_015958999.1.1464 WP_015958999.1.1478 WP_015958999.1.14813 WP_015958999.1.15331 WP_015958999.1.15491 WP_015958999.1.15942 WP_015958999.1.15994 WP_015958999.1.160 WP_015958999.1.16054 WP_015958999.1.16289 WP_015958999.1.16299 WP_015958999.1.16314 WP_015958999.1.16380 WP_015958999.1.16659 WP_015958999.1.16917 WP_015958999.1.17508 WP_015958999.1.17556 WP_015958999.1.1869 WP_015958999.1.187 WP_015958999.1.18736 WP_015958999.1.19317 WP_015958999.1.1937 WP_015958999.1.20122 WP_015958999.1.2023 WP_015958999.1.2031 WP_015958999.1.21088 WP_015958999.1.21566 WP_015958999.1.21772 WP_015958999.1.2193 WP_015958999.1.21953 WP_015958999.1.21968 WP_015958999.1.22044 WP_015958999.1.22215 WP_015958999.1.22405 WP_015958999.1.22534 WP_015958999.1.2258 WP_015958999.1.22584 WP_015958999.1.22686 WP_015958999.1.22712 WP_015958999.1.2272 WP_015958999.1.22836 WP_015958999.1.22929 WP_015958999.1.22956 WP_015958999.1.23145 WP_015958999.1.23437 WP_015958999.1.2347 WP_015958999.1.23758 WP_015958999.1.24036 WP_015958999.1.24103 WP_015958999.1.24342 WP_015958999.1.2447 WP_015958999.1.24590 WP_015958999.1.24816 WP_015958999.1.25163 WP_015958999.1.2536 WP_015958999.1.25407 WP_015958999.1.25563 WP_015958999.1.25904 WP_015958999.1.25918 WP_015958999.1.26308 WP_015958999.1.26336 WP_015958999.1.26427 WP_015958999.1.26843 WP_015958999.1.26974 WP_015958999.1.27543 WP_015958999.1.27550 WP_015958999.1.27828 WP_015958999.1.27925 WP_015958999.1.28115 WP_015958999.1.2814 WP_015958999.1.28152 WP_015958999.1.28203 WP_015958999.1.28446 WP_015958999.1.28463 WP_015958999.1.28660 WP_015958999.1.28764 WP_015958999.1.29120 WP_015958999.1.29152 WP_015958999.1.29240 WP_015958999.1.29334 WP_015958999.1.29448 WP_015958999.1.2990 WP_015958999.1.29915 WP_015958999.1.29974 WP_015958999.1.30218 WP_015958999.1.30339 WP_015958999.1.31064 WP_015958999.1.3111 WP_015958999.1.31400 WP_015958999.1.31591 WP_015958999.1.31601 WP_015958999.1.31920 WP_015958999.1.32013 WP_015958999.1.32023 WP_015958999.1.32086 WP_015958999.1.32354 WP_015958999.1.32854 WP_015958999.1.33399 WP_015958999.1.33446 WP_015958999.1.33498 WP_015958999.1.33539 WP_015958999.1.33985 WP_015958999.1.34173 WP_015958999.1.34213 WP_015958999.1.34258 WP_015958999.1.34507 WP_015958999.1.34850 WP_015958999.1.34853 WP_015958999.1.34910 WP_015958999.1.35284 WP_015958999.1.35453 WP_015958999.1.35574 WP_015958999.1.35645 WP_015958999.1.35786 WP_015958999.1.35914 WP_015958999.1.36025 WP_015958999.1.36080 WP_015958999.1.36151 WP_015958999.1.3628 WP_015958999.1.36388 WP_015958999.1.36998 WP_015958999.1.37391 WP_015958999.1.37422 WP_015958999.1.37565 WP_015958999.1.37614 WP_015958999.1.37860 WP_015958999.1.388 WP_015958999.1.38838 WP_015958999.1.38849 WP_015958999.1.39149 WP_015958999.1.39418 WP_015958999.1.39456 WP_015958999.1.39532 WP_015958999.1.39534 WP_015958999.1.40054 WP_015958999.1.40295 WP_015958999.1.40551 WP_015958999.1.40597 WP_015958999.1.4069 WP_015958999.1.4072 WP_015958999.1.40798 WP_015958999.1.40825 WP_015958999.1.41096 WP_015958999.1.41405 WP_015958999.1.41563 WP_015958999.1.41794 WP_015958999.1.41895 WP_015958999.1.42054 WP_015958999.1.42264 WP_015958999.1.42584 WP_015958999.1.42724 WP_015958999.1.42881 WP_015958999.1.43221 WP_015958999.1.43228 WP_015958999.1.43833 WP_015958999.1.43853 WP_015958999.1.4393 WP_015958999.1.44117 WP_015958999.1.4416 WP_015958999.1.44235 WP_015958999.1.44708 WP_015958999.1.44931 WP_015958999.1.45821 WP_015958999.1.46288 WP_015958999.1.46384 WP_015958999.1.4664 WP_015958999.1.46971 WP_015958999.1.47521 WP_015958999.1.48496 WP_015958999.1.48793 WP_015958999.1.48859 WP_015958999.1.48887 WP_015958999.1.49052 WP_015958999.1.49209 WP_015958999.1.49438 WP_015958999.1.49579 WP_015958999.1.49933 WP_015958999.1.50018 WP_015958999.1.50029 WP_015958999.1.50541 WP_015958999.1.50672 WP_015958999.1.50831 WP_015958999.1.50866 WP_015958999.1.51347 WP_015958999.1.51413 WP_015958999.1.5143 WP_015958999.1.51438 WP_015958999.1.51614 WP_015958999.1.51698 WP_015958999.1.5181 WP_015958999.1.52012 WP_015958999.1.52275 WP_015958999.1.5259 WP_015958999.1.52678 WP_015958999.1.52920 WP_015958999.1.53122 WP_015958999.1.53442 WP_015958999.1.53597 WP_015958999.1.54786 WP_015958999.1.55171 WP_015958999.1.5535 WP_015958999.1.55515 WP_015958999.1.55738 WP_015958999.1.5682 WP_015958999.1.56847 WP_015958999.1.57310 WP_015958999.1.57325 WP_015958999.1.57475 WP_015958999.1.57501 WP_015958999.1.57624 WP_015958999.1.57630 WP_015958999.1.57648 WP_015958999.1.57886 WP_015958999.1.5797 WP_015958999.1.58479 WP_015958999.1.58865 WP_015958999.1.58985 WP_015958999.1.58994 WP_015958999.1.5903 WP_015958999.1.59042 WP_015958999.1.59069 WP_015958999.1.5951 WP_015958999.1.59661 WP_015958999.1.59796 WP_015958999.1.59865 WP_015958999.1.60060 WP_015958999.1.60276 WP_015958999.1.60372 WP_015958999.1.60564 WP_015958999.1.60681 WP_015958999.1.60830 WP_015958999.1.60843 WP_015958999.1.60972 WP_015958999.1.61618 WP_015958999.1.61898 WP_015958999.1.620 WP_015958999.1.62090 WP_015958999.1.62111 WP_015958999.1.62126 WP_015958999.1.62188 WP_015958999.1.62226 WP_015958999.1.62664 WP_015958999.1.62765 WP_015958999.1.63351 WP_015958999.1.6346 WP_015958999.1.63610 WP_015958999.1.63671 WP_015958999.1.63785 WP_015958999.1.63802 WP_015958999.1.64114 WP_015958999.1.64140 WP_015958999.1.64339 WP_015958999.1.6442 WP_015958999.1.64826 WP_015958999.1.64852 WP_015958999.1.65723 WP_015958999.1.6591 WP_015958999.1.660 WP_015958999.1.66020 WP_015958999.1.66152 WP_015958999.1.66236 WP_015958999.1.66292 WP_015958999.1.66555 WP_015958999.1.66895 WP_015958999.1.67399 WP_015958999.1.67765 WP_015958999.1.68090 WP_015958999.1.6823 WP_015958999.1.68533 WP_015958999.1.6868 WP_015958999.1.6885 WP_015958999.1.69212 WP_015958999.1.69459 WP_015958999.1.69947 WP_015958999.1.6997 WP_015958999.1.70009 WP_015958999.1.70050 WP_015958999.1.70140 WP_015958999.1.70666 WP_015958999.1.70966 WP_015958999.1.71056 WP_015958999.1.71100 WP_015958999.1.71387 WP_015958999.1.71611 WP_015958999.1.71704 WP_015958999.1.71720 WP_015958999.1.71751 WP_015958999.1.7223 WP_015958999.1.72899 WP_015958999.1.73009 WP_015958999.1.7320 WP_015958999.1.73319 WP_015958999.1.73510 WP_015958999.1.73691 WP_015958999.1.73780 WP_015958999.1.73887 WP_015958999.1.74447 WP_015958999.1.74788 WP_015958999.1.7493 WP_015958999.1.75283 WP_015958999.1.75307 WP_015958999.1.75398 WP_015958999.1.75418 WP_015958999.1.75501 WP_015958999.1.75888 WP_015958999.1.75962 WP_015958999.1.76107 WP_015958999.1.76245 WP_015958999.1.76370 WP_015958999.1.7649 WP_015958999.1.76496 WP_015958999.1.76512 WP_015958999.1.76657 WP_015958999.1.76943 WP_015958999.1.77211 WP_015958999.1.7730 WP_015958999.1.77340 WP_015958999.1.77519 WP_015958999.1.777 WP_015958999.1.78171 WP_015958999.1.78268 WP_015958999.1.78290 WP_015958999.1.78354 WP_015958999.1.78421 WP_015958999.1.79091 WP_015958999.1.79211 WP_015958999.1.79582 WP_015958999.1.79625 WP_015958999.1.79857 WP_015958999.1.80554 WP_015958999.1.80767 WP_015958999.1.81139 WP_015958999.1.81255 WP_015958999.1.81329 WP_015958999.1.81350 WP_015958999.1.81488 WP_015958999.1.81851 WP_015958999.1.82211 WP_015958999.1.8252 WP_015958999.1.82659 WP_015958999.1.82704 WP_015958999.1.82769 WP_015958999.1.83300 WP_015958999.1.83337 WP_015958999.1.83379 WP_015958999.1.83608 WP_015958999.1.84224 WP_015958999.1.84627 WP_015958999.1.84783 WP_015958999.1.85497 WP_015958999.1.85523 WP_015958999.1.85622 WP_015958999.1.85812 WP_015958999.1.85877 WP_015958999.1.85965 WP_015958999.1.86339 WP_015958999.1.86533 WP_015958999.1.86778 WP_015958999.1.86899 WP_015958999.1.86932 WP_015958999.1.87 WP_015958999.1.87027 WP_015958999.1.87256 WP_015958999.1.87313 WP_015958999.1.87343 WP_015958999.1.87354 WP_015958999.1.87693 WP_015958999.1.87931 WP_015958999.1.88041 WP_015958999.1.88274 WP_015958999.1.88615 WP_015958999.1.8896 WP_015958999.1.89096 WP_015958999.1.89185 WP_015958999.1.89226 WP_015958999.1.89300 WP_015958999.1.89401 WP_015958999.1.89430 WP_015958999.1.8952 WP_015958999.1.89558 WP_015958999.1.89618 WP_015958999.1.89688 WP_015958999.1.89991 WP_015958999.1.90123 WP_015958999.1.90318 WP_015958999.1.90382 WP_015958999.1.90493 WP_015958999.1.90877 WP_015958999.1.91181 WP_015958999.1.91385 WP_015958999.1.91415 WP_015958999.1.91444 WP_015958999.1.91522 WP_015958999.1.91544 WP_015958999.1.91604 WP_015958999.1.91678 WP_015958999.1.92035 WP_015958999.1.92174 WP_015958999.1.92460 WP_015958999.1.92704 WP_015958999.1.92799 WP_015958999.1.93369 WP_015958999.1.93757 WP_015958999.1.94493 WP_015958999.1.94696 WP_015958999.1.94837 WP_015958999.1.94860 WP_015958999.1.9492 WP_015958999.1.9521 WP_015958999.1.95408 WP_015958999.1.95527 WP_015958999.1.95697 WP_015958999.1.95710 WP_015958999.1.96300 WP_015958999.1.96737 WP_015958999.1.96802 WP_015958999.1.96842 WP_015958999.1.96881 WP_015958999.1.97092 WP_015958999.1.97273 WP_015958999.1.97353 WP_015958999.1.9745 WP_015958999.1.97567 WP_015958999.1.97697 WP_015958999.1.97734 WP_015958999.1.97855 WP_015958999.1.98016 WP_015958999.1.98024 WP_015958999.1.98125 WP_015958999.1.98342 WP_015958999.1.98420 WP_015958999.1.98450 WP_015958999.1.98499 WP_015958999.1.98631 WP_015958999.1.98816 WP_015958999.1.98871 WP_015958999.1.99013 WP_015958999.1.99439 WP_015958999.1.99944 gi|152971984|ref|YP_001337093.1| 1ejw_C 1ejx_C 1fwj_C 1kra_C 2kau_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]