SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1enhA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1enhA
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Homeodomain-like 2.14e-27
Family Homeodomain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1enhA   PDB: 1enh   SUPERFAMILY: 1enhA
Sequence length 54
Comment (A:)
Sequence
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkraki
Download sequence
Identical sequences 1enhA 1enh_A cath|current|1enhA00/3-56 d1enha_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]