SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1eo5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1eo5A
Domain Number 1 Region: 11-404
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.01e-105
Family Amylase, catalytic domain 0.000000417
Further Details:      
 
Domain Number 2 Region: 583-685
Classification Level Classification E-value
Superfamily Starch-binding domain-like 7e-35
Family Starch-binding domain 0.000000868
Further Details:      
 
Domain Number 3 Region: 407-492
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.12e-29
Family alpha-Amylases, C-terminal beta-sheet domain 0.002
Further Details:      
 
Domain Number 4 Region: 498-577
Classification Level Classification E-value
Superfamily E set domains 4.4e-19
Family E-set domains of sugar-utilizing enzymes 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1eo5A   PDB: 1eo5
Sequence length 686
Comment (A:)
Sequence
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmaavkhmpfgwqk
sfmaavnnykpvftfgawflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrksnpaiaygstqerwinndvli
yerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllngntlsvgsggaasnf
tlaaggtavwqytaatatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgad
itswedtqikvkipavaggnynikvanaagtasnvydnfevlsgdqvsvrfvvnnattal
gqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvpagktiefkflkkqgstv
tweggsnhtftapssgtatinvnwqp
Download sequence
Identical sequences 1eo5_A 1eo7_A 1eo5A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]