SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1eodA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1eodA
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily POZ domain 4.22e-41
Family Tetramerization domain of potassium channels 0.00000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1eodA   PDB: 1eod   SUPERFAMILY: 1eodA
Sequence length 100
Comment (A:)
Sequence
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrpvdvpldvfseeikfyelgenaferyredegf
Download sequence
Identical sequences 1eodA 000072895|e1eodA1|226.1.1.2|A:1-100 cath|current|1eodA00/66-165 d1eoda_ 1eod_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]