SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1epwA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1epwA
Domain Number 1 Region: 1-532
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.44e-208
Family Clostridium neurotoxins, catalytic domain 0.0000000000148
Further Details:      
 
Domain Number 2 Region: 535-860
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 3.81e-126
Family Clostridium neurotoxins, "coiled-coil" domain 0.00000000000831
Further Details:      
 
Domain Number 3 Region: 1081-1290
Classification Level Classification E-value
Superfamily STI-like 1.1e-81
Family Clostridium neurotoxins, C-terminal domain 0.000000649
Further Details:      
 
Domain Number 4 Region: 859-1065
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.63e-46
Family Clostridium neurotoxins, the second last domain 0.00000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1epwA   PDB: 1epw
Sequence length 1290
Comment (A:)
Sequence
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqyl
ysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndf
vieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellip
vvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmyk
alnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvs
ylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdls
iytndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkl
tssanskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsg
wkisirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingk
lesntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsys
eylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyi
gekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisds
defyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcisk
wylkevkrkpynlklgcnwqfipkdegwte
Download sequence
Identical sequences 1epw_A 1f31_A 1g9a_A 1g9b_A 1g9c_A 1g9d_A 1i1e_A 1s0b_A 1s0c_A 1s0d_A 1s0e_A 1s0f_A 1s0g_A 2np0_A 1epwA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]