SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1etkA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1etkA
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily Homeodomain-like 7.07e-27
Family FIS-like 0.00000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1etkA   PDB: 1etk   SUPERFAMILY: 1etkA
Sequence length 98
Comment (A:)
Sequence
mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
plldmvmaytrgnqtraalmmginrgtlrkklkkygmn
Download sequence
Identical sequences 1etkA cath|current|1etkA00/9-98 cath|current|1etkB00/5-98 1etk_A 1etk_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]