SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1etoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1etoA
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily Homeodomain-like 3.65e-26
Family FIS-like 0.00000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1etoA   PDB: 1eto   SUPERFAMILY: 1etoA
Sequence length 98
Comment (A:)
Sequence
mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
plldmvmqytlgnqtraalmmginrgtlrkklkkygmn
Download sequence
Identical sequences 1eto_A 1eto_B cath|current|1etoA00/9-98 cath|current|1etoB00/1-98 d1etob_ 1etoA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]