SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1etqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1etqA
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily Homeodomain-like 3.01e-26
Family FIS-like 0.00000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1etqA   PDB: 1etq   SUPERFAMILY: 1etqA
Sequence length 98
Comment (A:)
Sequence
mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
plldmvmqytygnqtraalmmginrgtlrkklkkygmn
Download sequence
Identical sequences cath|current|1etqA00/10-98 cath|current|1etqB00/10-98 cath|current|1etqC00/11-98 cath|current|1etqD00/10-98 1etqA 1etq_A 1etq_B 1etq_C 1etq_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]