SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1etvA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1etvA
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily Homeodomain-like 8.21e-26
Family FIS-like 0.00000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1etvA   PDB: 1etv   SUPERFAMILY: 1etvA
Sequence length 98
Comment (A:)
Sequence
mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
plldmvmqytranqtraalmmginrgtlrkklkkygmn
Download sequence
Identical sequences 1etvA cath|current|1etvA00/9-98 cath|current|1etvB00/5-98 1etv_A 1etv_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]