SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1evlA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1evlA
Domain Number 1 Region: 1-290
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.06e-210
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000278
Further Details:      
 
Domain Number 2 Region: 292-387
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.32e-57
Family Anticodon-binding domain of Class II aaRS 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1evlA   PDB: 1evl
Sequence length 401
Comment (A:)
Sequence
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
Download sequence
Identical sequences 1evk_A 1evk_B 1evl_A 1evl_B 1evl_C 1evl_D 1fyf_A 1fyf_B 1kog_A 1kog_B 1kog_C 1kog_D 1kog_E 1kog_F 1kog_G 1kog_H 1evlA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]