SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ex2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ex2A
Domain Number 1 Region: 3-183
Classification Level Classification E-value
Superfamily ITPase-like 4.1e-101
Family Maf-like 0.000000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ex2A   PDB: 1ex2   SUPERFAMILY: 1ex2A
Sequence length 189
Comment (A:)
Sequence
MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRNFSPEENVQWLAKQKAKAVADL
HPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAENHSETFYD
KTEVAFWSLSEEEIWTYIETKEPMDKAGAYGIQGRGALFVKKIDGDYYSVMGLPISKTMR
ALRHFDIRA
Download sequence
Identical sequences A0A085C8I3 A0A0T8PJR6 A0A199WJJ6 L8ANW1 Q02169 U1ZBY1
APC121 NP_390683.1.22788 WP_004398496.1.100042 WP_004398496.1.11088 WP_004398496.1.11231 WP_004398496.1.11257 WP_004398496.1.1140 WP_004398496.1.11581 WP_004398496.1.12759 WP_004398496.1.1358 WP_004398496.1.15902 WP_004398496.1.16291 WP_004398496.1.18944 WP_004398496.1.19261 WP_004398496.1.20099 WP_004398496.1.20502 WP_004398496.1.23108 WP_004398496.1.27372 WP_004398496.1.27660 WP_004398496.1.2914 WP_004398496.1.31028 WP_004398496.1.31100 WP_004398496.1.31260 WP_004398496.1.32025 WP_004398496.1.32219 WP_004398496.1.32420 WP_004398496.1.32693 WP_004398496.1.32861 WP_004398496.1.33846 WP_004398496.1.34621 WP_004398496.1.35833 WP_004398496.1.36189 WP_004398496.1.37074 WP_004398496.1.3747 WP_004398496.1.39562 WP_004398496.1.39605 WP_004398496.1.40859 WP_004398496.1.42762 WP_004398496.1.44140 WP_004398496.1.44184 WP_004398496.1.45019 WP_004398496.1.47157 WP_004398496.1.5262 WP_004398496.1.54596 WP_004398496.1.54948 WP_004398496.1.54949 WP_004398496.1.56274 WP_004398496.1.56411 WP_004398496.1.57184 WP_004398496.1.57201 WP_004398496.1.5726 WP_004398496.1.57513 WP_004398496.1.6139 WP_004398496.1.63795 WP_004398496.1.64889 WP_004398496.1.6517 WP_004398496.1.65188 WP_004398496.1.65223 WP_004398496.1.65841 WP_004398496.1.69439 WP_004398496.1.71402 WP_004398496.1.7159 WP_004398496.1.7186 WP_004398496.1.71916 WP_004398496.1.72152 WP_004398496.1.72516 WP_004398496.1.72999 WP_004398496.1.74782 WP_004398496.1.76814 WP_004398496.1.76977 WP_004398496.1.78686 WP_004398496.1.78811 WP_004398496.1.79046 WP_004398496.1.79712 WP_004398496.1.79987 WP_004398496.1.80832 WP_004398496.1.81116 WP_004398496.1.81747 WP_004398496.1.82722 WP_004398496.1.84556 WP_004398496.1.88042 WP_004398496.1.88591 WP_004398496.1.89000 WP_004398496.1.89821 WP_004398496.1.90830 WP_004398496.1.91060 WP_004398496.1.91133 WP_004398496.1.9164 WP_004398496.1.91723 WP_004398496.1.93420 WP_004398496.1.94199 WP_004398496.1.95009 WP_004398496.1.96043 WP_004398496.1.97264 WP_004398496.1.979 WP_004398496.1.99091 WP_004398496.1.99399 1ex2A gi|560129771|ref|YP_008830912.1| cath|current|1ex2A00/1-185 cath|current|1ex2B00/1-185 cath|current|1excA00/1-185 cath|current|1excB00/1-185 1ex2_A 1ex2_B 1exc_A 1exc_B gi|472331153|ref|YP_007663429.1| gi|470163018|ref|YP_007534793.1| gi|16079857|ref|NP_390683.1| 224308.BSU28050 gi|384176388|ref|YP_005557773.1| gi|402776961|ref|YP_006630905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]