SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1f36A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1f36A
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily Homeodomain-like 7.53e-27
Family FIS-like 0.00000513
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1f36A   PDB: 1f36   SUPERFAMILY: 1f36A
Sequence length 98
Comment (A:)
Sequence
mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalenyfaqlngqdvndlyelvlaeveq
plldmvmqytrgnqtraalmmginrgtlrkklkkygmn
Download sequence
Identical sequences cath|current|1f36A00/10-98 cath|current|1f36B00/10-98 1f36_A 1f36_B 1f36A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]