SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1f82A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1f82A
Domain Number 1 Region: 1-424
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.08e-176
Family Clostridium neurotoxins, catalytic domain 0.00000000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1f82A   PDB: 1f82   SUPERFAMILY: 1f82A
Sequence length 424
Comment (A:)
Sequence
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeis
Download sequence
Identical sequences 1f82A 000118301|e1f82A1|2498.1.1.16|A:1-424 cath|current|1f82A00/1-424 cath|current|1fqhA00/1-424 d1f82a_ d1fqha_ 1f82_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]