SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1f83A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1f83A
Domain Number 1 Region: 1-424
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.04e-176
Family Clostridium neurotoxins, catalytic domain 0.0000000000000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1f83A   PDB: 1f83   SUPERFAMILY: 1f83A
Sequence length 425
Comment (A:)
Sequence
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeisk
Download sequence
Identical sequences 1f83A cath|current|1f83A00/1-425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]