SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1fexA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fexA
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily Homeodomain-like 1.51e-18
Family Myb/SANT domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1fexA   PDB: 1fex   SUPERFAMILY: 1fexA
Sequence length 59
Comment (A:)
Sequence
griaftdaddvailtyvkenarspssvtgnalwkamekssltqhswqslkdrylkhlrg
Download sequence
Identical sequences 000002482|e1fexA1|101.1.1.43|A:1-59 cath|current|1fexA00/1-59 d1fexa_ 1fex_A trt001000207.1 1fexA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]