SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ff2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ff2A
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.99e-23
Family 7-Fe ferredoxin 0.00000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ff2A   PDB: 1ff2   SUPERFAMILY: 1ff2A
Sequence length 106
Comment (A:)
Sequence
afvvtdncikckytdcvevcpvdcfyegpnflvihpdeciddalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 1ff2A 000066992|e1ff2A1|205.1.1.4|A:1-106 cath|current|1ff2A00/1-106 d1ff2a_ 1ff2_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]