SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1fioA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fioA
Domain Number 1 Region: 2-195
Classification Level Classification E-value
Superfamily t-snare proteins 7.17e-43
Family t-snare proteins 0.00000000563
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1fioA   PDB: 1fio   SUPERFAMILY: 1fioA
Sequence length 196
Comment (A:)
Sequence
mhdfvgfmnkisqinrdldkydhtinqvdslhkrlltevneeqashlrhsldnfvaqatd
lqfklkneiksaqrdgihdtnkqaqaensrqrflkliqdyrivdsnykeenkeqakrqym
iiqpeatedeveaaisdvggqqifsqallnanrrgeaktalaevqarhqellkleksmae
ltqlfndmeelvieqq
Download sequence
Identical sequences cath|current|1fioA00/30-225 d1fioa_ 1fioA 1fio_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]