SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1fipA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fipA
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily Homeodomain-like 1.56e-26
Family FIS-like 0.00000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1fipA   PDB: 1fip   SUPERFAMILY: 1fipA
Sequence length 98
Comment (A:)
Sequence
mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
alldmvmqytrgnqtraalmmginrgtlrkklkkygmn
Download sequence
Identical sequences 1fip_A 1fip_B 1fipA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]