SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1fjlA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fjlA
Domain Number 1 Region: 15-76
Classification Level Classification E-value
Superfamily Homeodomain-like 5.7e-42
Family Homeodomain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1fjlA   PDB: 1fjl   SUPERFAMILY: 1fjlA
Sequence length 81
Comment (A:)
Sequence
edisdcesepgialkrkqrrsrttfsasqldelerafertqypdiytreelaqrtnltea
riqvwfqnrrarlrkqhtsvs
Download sequence
Identical sequences 1fjlA 1fjl_A 1fjl_B 1fjl_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]