SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1fkmA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fkmA
Domain Number 1 Region: 7-146,175-221
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.46e-57
Family Ypt/Rab-GAP domain of gyp1p 0.000000019
Further Details:      
 
Domain Number 2 Region: 196-382
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.81e-57
Family Ypt/Rab-GAP domain of gyp1p 0.00000000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1fkmA   PDB: 1fkm
Sequence length 396
Comment (A:)
Sequence
mnsiiqriskfdnilkdktiinqqdlrqiswngipkihrpvvwklligylpvntkrqegf
lqrkrkeyrdslkhtfsdqhsrdiptwhqieidiprtnphiplyqfksvqnslqrilylw
airhpasgyvqgindlvtpffetflteylppsqiddveikdpstymvdeqitdleadtfw
cltklleqitdnyihgqpgilrqvknlsqlvkridadlynhfqnehvefiqfafrwmncl
lmrefqmgtvirmwdtylsetsqevtssysmssndikppvtpteprvasfvtptkdfqsp
ttalsnmtpnnavedsgkmrqsslnefhvfvcaaflikwsdqlmemdfqetitflqnppt
kdwtetdiemllseafiwqslykdatshwlhhhhhh
Download sequence
Identical sequences 1fkm_A 1fkmA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]