SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1floA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1floA
Domain Number 1 Region: 135-421
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 8.05e-121
Family Lambda integrase-like, catalytic core 0.0000000000381
Further Details:      
 
Domain Number 2 Region: 1-128
Classification Level Classification E-value
Superfamily lambda integrase-like, N-terminal domain 3.29e-84
Family lambda integrase-like, N-terminal domain 0.000000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1floA   PDB: 1flo
Sequence length 422
Comment (A:)
Sequence
pqfdilcktppkvlvrqfverferpsgekialcaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyygqkhqsditdivs
slqlqfesseeadkgnshskkmlkallsegesiweitekilnsfeytsrftktktlyqfl
flatfincgrfsdiknvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridp
lvyldeflrnsepvlkrvnrtgnsssnkqeyqllkdnlvrsynkalkknapysifaikng
pkshigrhlmtsflsmkglteltnvvgnwsdkrasavarttythqitaipdhyfalvsry
yaydpiskemialkdetnpieewqhieqlkgsaegsirypawngiisqevldylssyinr
ri
Download sequence
Identical sequences 1flo_A 1flo_B 1flo_C 1flo_D 1floA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]