SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1fohA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fohA
Domain Number 1 Region: 466-660
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.93e-61
Family Glutathione peroxidase-like 0.0000000025
Further Details:      
 
Domain Number 2 Region: 5-244,345-461
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.65e-58
Family FAD-linked reductases, N-terminal domain 0.00000000000722
Further Details:      
 
Domain Number 3 Region: 241-341
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9e-37
Family PHBH-like 0.000000992
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1fohA   PDB: 1foh
Sequence length 664
Comment (A:)
Sequence
tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg
hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekgg
rvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdach
thspkagqgmntsmmdtynlgwklglvltgrakrdilktyeeerhafaqalidfdhqfsr
lfsgrpakdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvv
gtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfsayldsens
vislytpkvsdrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphp
ksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwt
ksta
Download sequence
Identical sequences 1foh_A 1foh_B 1foh_C 1foh_D 1fohA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]