SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1frdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1frdA
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.22e-38
Family 2Fe-2S ferredoxin-related 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1frdA   PDB: 1frd   SUPERFAMILY: 1frdA
Sequence length 98
Comment (A:)
Sequence
asyqvrlinkkqdidttieideettildgaeengielpfschsgscsscvgkvvegevdq
sdqiflddeqmgkgfallcvtyprsnctikthqepyla
Download sequence
Identical sequences cath|current|1frdA00/1-98 d1frda_ 1frdA 1frd_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]