SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1frkA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1frkA
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.68e-26
Family 7-Fe ferredoxin 0.00000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1frkA   PDB: 1frk   SUPERFAMILY: 1frkA
Sequence length 106
Comment (A:)
Sequence
afvvtdncikckytdcvevcpvdcfyegpnflvidpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 1frkA 000066979|e1frkA1|205.1.1.4|A:1-106 cath|current|1frkA00/1-106 d1frka_ 1frk_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]