SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1frlA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1frlA
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.65e-25
Family 7-Fe ferredoxin 0.00000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1frlA   PDB: 1frl   SUPERFAMILY: 1frlA
Sequence length 106
Comment (A:)
Sequence
afvvtdncikckytdcvevcpvdcfyegpnflvihpdscidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 000066990|e1frlA1|205.1.1.3|A:1-106 cath|current|1frlA00/1-106 d1frla_ 1frl_A 1frlA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]