SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1g2hA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1g2hA
Domain Number 1 Region: 4-60
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000347
Family FIS-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1g2hA   PDB: 1g2h   SUPERFAMILY: 1g2hA
Sequence length 61
Comment (A:)
Sequence
savisldefenktldeiigfyeaqvlklfyaeypstrklaqrlgvshtaianklkqygig
k
Download sequence
Identical sequences 1g2h_A 000002510|e1g2hA1|101.1.1.80|A:1-61 cath|current|1g2hA00/1-61 d1g2ha_ 1g2hA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]